SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yz8P from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yz8P
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Homeodomain-like 1.15e-25
Family Homeodomain 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yz8P   PDB: 1yz8
Sequence length 68
Comment (P:)
Sequence
gsqrrqrthftsqqlqqleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrk
reefivtd
Download sequence
Identical sequences 1yz8P cath|current|1yz8P00/-2-66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]