SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yzmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yzmA
Domain Number 1 Region: 5-48
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 2.56e-18
Family Rabenosyn-5 Rab-binding domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1yzmA   PDB: 1yzm
Sequence length 51
Comment (A:)
Sequence
gplgspllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqqtek
Download sequence
Identical sequences 1yzmA 1yzm_A cath|current|1yzmA00/456-501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]