SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z0jB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z0jB
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 3.81e-18
Family Rabenosyn-5 Rab-binding domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1z0jB   PDB: 1z0j
Sequence length 59
Comment (B:)
Sequence
gspeaeepieeelllqqidnikayifdakqcgrldevevltenlrelkhtlakqkggtd
Download sequence
Identical sequences 1z0jB 1z0j_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]