SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z0kB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z0kB
Domain Number 1 Region: 8-66
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 1.39e-20
Family Rabenosyn-5 Rab-binding domain-like 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1z0kB   PDB: 1z0k
Sequence length 69
Comment (B:)
Sequence
gplgsaegwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqd
eydqqqtek
Download sequence
Identical sequences 1z0kB 1z0k_B 1z0k_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]