SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z3eB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z3eB
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 4.03e-39
Family C-terminal domain of RNA polymerase alpha subunit 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1z3eB   PDB: 1z3e
Sequence length 73
Comment (B:)
Sequence
mekekvlemtieeldlsvrsynclkragintvqelankteedmmkvrnlgrksleevkak
leelglglrkddg
Download sequence
Identical sequences 1z3eB cath|current|1z3eB00/245-311 1z3e_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]