SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z5sC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z5sC
Domain Number 1 Region: 16-171
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 3.29e-61
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1z5sC   PDB: 1z5s
Sequence length 172
Comment (C:)
Sequence
slntgepapvlsspppadvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflk
vssvfkdeatvrmavqdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianl
ygplmalnhmvqqdyfpkalaplllafvtkpnsalescsfarhsllqtlykv
Download sequence
Identical sequences 1z5sC 1z5s_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]