SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z7mA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z7mA
Domain Number 1 Region: 34-339
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.73e-50
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1z7mA   PDB: 1z7m
Sequence length 344
Comment (A:)
Sequence
mrgshhhhhhgsiegrmekinyllpeesaemtlnqvkslrqiegrlrklfslknyqevmp
psfeytqlytalesngktfnqekmfqfikhegqsitlrydftlplvrlysqikdstsary
syfgkifrkekrhkgrstenyqigielfgesadkseleilslalqvieqlglnktvfeig
sakffqrlcqladgstelltelllkkdlsglnafieknnfskelrgllkeifitnelsrl
enlvtntkddvlissfdqlkefseklsmikpiiidlgmvpkmdyytdlmfkayssaanqp
ilsggrydqllsnfqeeafaigfcchmdtilkalerqeleednd
Download sequence
Identical sequences 1z7m_A 1z7m_B 1z7m_C 1z7m_D 1z7n_A 1z7n_B 1z7n_C 1z7n_D 1z7mA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]