SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z7qG from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z7qG
Domain Number 1 Region: 13-241
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.5e-83
Family Proteasome subunits 0.00000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1z7qG   PDB: 1z7q
Sequence length 288
Comment (G:)
Sequence
MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLV
PQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYV
QAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLV
DHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAI
DFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE
Download sequence
Identical sequences A0A0L8VGR4 A0A250WAF0 A6ZPJ2 B3LK19 C7GNQ6 C8ZHB0 E7KUT1 E7M0U8 E7NMW3 E7QL52 G2WNM3 H0GP49 N1NXJ2 P21242
NP_015007.1.97178 YOR362C YOR362C YOR362C YOR362C YOR362C YOR362C tr|A6ZPJ2|A6ZPJ2_YEAS7 YOR362C SCRT_01737 YOR362C YOR362C YOR362C 4932.YOR362C YOR362C YOR362C YOR362C YOR362C YOR362C YOR362C YOR362C 1z7qG YOR362C YOR362C 1z7q_G 1z7q_U 3jco_G 3jco_g 3jcp_G 3jcp_g 3nzj_F 3nzj_T 3nzw_F 3nzw_T 3nzx_F 3nzx_T 3un4_F 3un4_T 3un8_F 3un8_T 4cr2_G 4cr3_G 4cr4_G 4g4s_G 4inr_F 4inr_T 4int_F 4int_T 4inu_F 4inu_T 4j70_F 4j70_T 4jsq_F 4jsq_T 4jsu_F 4jsu_T 4jt0_F 4jt0_T 4nnn_F 4nnn_T 4nnw_F 4nnw_T 4no1_F 4no1_T 4no6_F 4no6_T 4no8_F 4no8_T 4no9_F 4no9_T 4q1s_F 4q1s_T 4qby_F 4qby_T 4qlq_F 4qlq_T 4qls_F 4qls_T 4qlt_F 4qlt_T 4qlu_F 4qlu_T 4qlv_F 4qlv_T 4qux_F 4qux_T 4quy_F 4quy_T 4qv0_F 4qv0_T 4qv1_F 4qv1_T 4qv3_F 4qv3_T 4qv4_F 4qv4_T 4qv5_F 4qv5_T 4qv6_F 4qv6_T 4qv7_F 4qv7_T 4qv8_F 4qv8_T 4qv9_F 4qv9_T 4qvl_F 4qvl_T 4qvm_F 4qvm_T 4qvn_F 4qvn_T 4qvp_F 4qvp_T 4qvq_F 4qvq_T 4qvv_F 4qvv_T 4qvw_F 4qvw_T 4qvy_F 4qvy_T 4qw0_F 4qw0_T 4qw1_F 4qw1_T 4qw3_F 4qw3_T 4qw4_F 4qw4_T 4qw5_F 4qw5_T 4qw6_F 4qw6_T 4qw7_F 4qw7_T 4qwf_F 4qwf_T 4qwg_F 4qwg_T 4qwi_F 4qwi_T 4qwj_F 4qwj_T 4qwk_F 4qwk_T 4qwl_F 4qwl_T 4qwr_F 4qwr_T 4qws_F 4qws_T 4qwu_F 4qwu_T 4qwx_F 4qwx_T 4qxj_F 4qxj_T 4qz0_F 4qz0_T 4qz1_F 4qz1_T 4qz2_F 4qz2_T 4qz3_F 4qz3_T 4qz4_F 4qz4_T 4qz5_F 4qz5_T 4qz6_F 4qz6_T 4qz7_F 4qz7_T 4qzw_F 4qzw_T 4qzx_F 4qzx_T 4qzz_F 4qzz_T 4r00_F 4r00_T 4r02_F 4r02_T 4r17_F 4r17_T 4r18_F 4r18_T 4rur_F 4rur_T 4x6z_G 4x6z_U 4y69_F 4y69_T 4y6a_F 4y6a_T 4y6v_F 4y6v_T 4y6z_F 4y6z_T 4y70_F 4y70_T 4y74_F 4y74_T 4y75_F 4y75_T 4y77_F 4y77_T 4y78_F 4y78_T 4y7w_F 4y7w_T 4y7x_F 4y7x_T 4y7y_F 4y7y_T 4y80_F 4y80_T 4y81_F 4y81_T 4y82_F 4y82_T 4y84_F 4y84_T 4y8g_F 4y8g_T 4y8h_F 4y8h_T 4y8i_F 4y8i_T 4y8j_F 4y8j_T 4y8k_F 4y8k_T 4y8l_F 4y8l_T 4y8m_F 4y8m_T 4y8n_F 4y8n_T 4y8o_F 4y8o_T 4y8p_F 4y8p_T 4y8q_F 4y8q_T 4y8r_F 4y8r_T 4y8s_F 4y8s_T 4y8t_F 4y8t_T 4y8u_F 4y8u_T 4y9y_F 4y9y_T 4y9z_F 4y9z_T 4ya0_F 4ya0_T 4ya1_F 4ya1_T 4ya2_F 4ya2_T 4ya3_F 4ya3_T 4ya4_F 4ya4_T 4ya5_F 4ya5_T 4ya7_F 4ya7_T 4ya9_F 4ya9_T 4z1l_F 4z1l_T 5a5b_G 5ahj_F 5ahj_T 5bou_F 5bou_T 5bxl_F 5bxl_T 5bxn_F 5bxn_T 5cgf_F 5cgf_T 5cgg_F 5cgg_T 5cgh_F 5cgh_T 5cgi_F 5cgi_T 5cz4_F 5cz4_T 5cz5_F 5cz5_T 5cz6_F 5cz6_T 5cz7_F 5cz7_T 5cz8_F 5cz8_T 5cz9_F 5cz9_T 5cza_F 5cza_T 5d0s_F 5d0s_T 5d0t_F 5d0t_T 5d0v_F 5d0v_T 5d0w_F 5d0w_T 5d0x_F 5d0x_T 5d0z_F 5d0z_T 5dki_F 5dki_T 5dkj_F 5dkj_T 5fg7_F 5fg7_T 5fg9_F 5fg9_T 5fga_F 5fga_T 5fgd_F 5fgd_T 5fge_F 5fge_T 5fgf_F 5fgf_T 5fgg_F 5fgg_T 5fgh_F 5fgh_T 5fgi_F 5fgi_T 5fhs_F 5fhs_T 5jhr_F 5jhr_T 5jhs_F 5jhs_T 5l52_F 5l52_T 5l54_F 5l54_T 5l55_F 5l55_T 5l5a_F 5l5a_T 5l5b_F 5l5b_T 5l5d_F 5l5d_T 5l5e_F 5l5e_T 5l5f_F 5l5f_T 5l5h_F 5l5h_T 5l5i_F 5l5i_T 5l5j_F 5l5j_T 5l5o_F 5l5o_T 5l5p_F 5l5p_T 5l5q_F 5l5q_T 5l5r_F 5l5r_T 5l5s_F 5l5s_T 5l5t_F 5l5t_T 5l5u_F 5l5u_T 5l5v_F 5l5v_T 5l5w_F 5l5w_T 5l5x_F 5l5x_T 5l5y_F 5l5y_T 5l5z_F 5l5z_T 5l60_F 5l60_T 5l61_F 5l61_T 5l62_F 5l62_T 5l63_F 5l63_T 5l64_F 5l64_T 5l65_F 5l65_T 5l66_F 5l66_T 5l67_F 5l67_T 5l68_F 5l68_T 5l69_F 5l69_T 5l6a_F 5l6a_T 5l6b_F 5l6b_T 5l6c_F 5l6c_T 5lai_F 5lai_T 5laj_F 5laj_T 5ltt_F 5ltt_T 5m2b_F 5m2b_T 5mp9_G 5mp9_g 5mpa_G 5mpa_g 5mpb_G 5mpb_g 5mpc_G 5mpc_g 5nif_G 5nif_U 5wvi_G 5wvi_k 5wvk_G 5wvk_k 6ef3_G 6g7f_F 6g7f_T 6g8m_F 6g8m_T 6g8n_F 6g8n_T 6gop_F 6gop_T YOR362C YOR362c___KOG0184 YOR362C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]