SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zpdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zpdA
Domain Number 1 Region: 371-543
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.29e-55
Family Pyruvate oxidase and decarboxylase PP module 0.0000000539
Further Details:      
 
Domain Number 2 Region: 3-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.97e-41
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000383
Further Details:      
 
Domain Number 3 Region: 191-352
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.68e-25
Family Pyruvate oxidase and decarboxylase, middle domain 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zpdA   PDB: 1zpd
Sequence length 568
Comment (A:)
Sequence
msytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegy
arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktd
yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp
asalfndeasdeaslnaavdetlkfianrdkvavlvgsklraagaeeaavkftdalggav
atmaaaksffpeenalyigtswgevsypgvektmkeadavialapvfndysttgwtdipd
pkklvlaeprsvvvngirfpsvhlkdyltrlaqkvskktgsldffkslnagelkkaapad
psaplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvp
aafgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgp
ynniknwdyaglmevfngnggydsgaakglkaktggelaeaikvalantdgptliecfig
redcteelvkwgkrvaaansrkpvnkvv
Download sequence
Identical sequences 1zpd_A 1zpd_B 1zpd_E 1zpd_F 1zpdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]