SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zt2B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zt2B
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily PriB N-terminal domain-like 9.52e-51
Family PriB N-terminal domain-like 0.00000000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zt2B   PDB: 1zt2
Sequence length 212
Comment (B:)
Sequence
maldvkkypfikslddelkkygggitltdlllnsttlidqakdriqktksgdelphyvsy
nepvlvfyttllslailndvklirryayaeakqfrsllhteneenlleisklldlkinrc
dpikfylekkrriiqkefcvhfidylkytkdlkedwklsgqilhkgyvyldknqliglia
esikskivemirplnlkeipeklkslierrgi
Download sequence
Identical sequences 1zt2B 1zt2_B 1zt2_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]