SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ztrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ztrA
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily Homeodomain-like 2.67e-24
Family Homeodomain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ztrA   PDB: 1ztr
Sequence length 61
Comment (A:)
Sequence
gdekrprtafsseqlarakrefnenrylterrrqqlsselglneaqikiwfqnkrakirr
s
Download sequence
Identical sequences 1ztr_A 1ztrA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]