SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zunA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zunA
Domain Number 1 Region: 25-229
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.47e-77
Family PAPS reductase-like 0.00000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zunA   PDB: 1zun
Sequence length 325
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmvdklthlkqleaesihiirevaaefdnpvmlysigkdsa
vmlhlarkaffpgklpfpvmhvdtrwkfqemyrfrdqmveemgldlithinpdgvaqgin
pfthgsakhtdimkteglkqaldkhgfdaafggarrdeeksrakervysfrdskhrwdpk
nqrpelwnvyngnvnkgesirvfplsnwteldiwqyiylegipivplyfaaerdviekng
tlimidderilehltdeeksrivkkkvrfrtlgcypltgaveseatsltdiiqemlltrt
serqgrvidhdgagsmeekkrqgyf
Download sequence
Identical sequences 1zunA 1zun_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]