SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zwyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zwyA
Domain Number 1 Region: 12-182
Classification Level Classification E-value
Superfamily ITPase-like 2.93e-63
Family YjjX-like 0.0000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zwyA   PDB: 1zwy
Sequence length 185
Comment (A:)
Sequence
namppiikrrvmrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsde
etkqgalnrvrnakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlppl
vlerlrqakelgdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpe
hypsa
Download sequence
Identical sequences 1zwy_A 1zwy_B 1zwy_C 1zwy_D 1zwyA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]