SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zzkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zzkA
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zzkA   PDB: 1zzk
Sequence length 82
Comment (A:)
Sequence
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff
Download sequence
Identical sequences 1zzkA cath|current|1zziA00/8-89 cath|current|1zziB00/11-89 cath|current|1zzjA00/9-83 cath|current|1zzjB00/9-81 cath|current|1zzjC00/8-81 cath|current|1zzkA00/10-89 1zzi_A 1zzi_B 1zzj_A 1zzj_B 1zzj_C 1zzk_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]