SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2a1hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2a1hA
Domain Number 1 Region: 18-361
Classification Level Classification E-value
Superfamily D-aminoacid aminotransferase-like PLP-dependent enzymes 1.46e-154
Family D-aminoacid aminotransferase-like PLP-dependent enzymes 0.00000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2a1hA   PDB: 2a1h
Sequence length 365
Comment (A:)
Sequence
asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
wmfpv
Download sequence
Identical sequences 2a1hA d1ekfa_ d1ekfb_ d1ekpa_ d1ekpb_ d1ekva_ d1ekvb_ d1kt8a_ d1kt8b_ d1ktaa_ d1ktab_ d2hhfa_ d2hhfb_ d5mpra1 1ekf_A 1ekf_B 1ekp_A 1ekp_B 1ekv_A 1ekv_B 1kt8_A 1kt8_B 1kta_A 1kta_B 2a1h_A 2a1h_B 2hhf_A 2hhf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]