SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2a1uA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2a1uA
Domain Number 1 Region: 21-207
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.4e-59
Family ETFP subunits 0.0000000126
Further Details:      
 
Domain Number 2 Region: 210-329
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.88e-50
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2a1uA   PDB: 2a1u
Sequence length 333
Comment (A:)
Sequence
MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEVSCLVAGTKC
DKVAQDLCKVAGIAKVLVAQHDVYKGLLPEELTPLILATQKQFNYTHICAGASAFGKNLL
PRVAAKLEVAPISDIIAIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFDAAATSG
GSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQ
LHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAIN
KDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
Download sequence
Identical sequences A0A0S2Z3L0 P13804
ENSP00000452762 ENSP00000399273 NP_000117.1.87134 NP_000117.1.92137 HR6715 2a1uA ENSP00000452762 9606.ENSP00000267950 Hs4503607___KOG3954 gi|4503607|ref|NP_000117.1| 1t9g_R 2a1t_R 2a1u_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]