SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2a1xA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2a1xA
Domain Number 1 Region: 14-306
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.52e-87
Family PhyH-like 0.0000000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2a1xA   PDB: 2a1x
Sequence length 308
Comment (A:)
Sequence
sgtissasfhpqqfqytldnnvltleqrkfyeengflviknlvpdadiqrfrnefekicr
kevkplgltvmrdvtiskseyapsekmitkvqdfqedkelfryctlpeilkyvecftgpn
imamhtmlinkppdsgkktsrhplhqdlhyfpfrpsdlivcawtamehisrnngclvvlp
gthkgslkphdypkweggvnkmfhgiqdyeenkarvhlvmekgdtvffhpllihgsgqnk
tqgfrkaischfasadchyidvkgtsqeniekevvgiahkffgaensvnlkdiwmfrarl
vkgertnl
Download sequence
Identical sequences 2a1x_A 2a1xA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]