SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ajeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ajeA
Domain Number 1 Region: 10-102
Classification Level Classification E-value
Superfamily Homeodomain-like 2.31e-17
Family Myb/SANT domain 0.00000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ajeA   PDB: 2aje
Sequence length 105
Comment (A:)
Sequence
gshmledpqrrirrpfsvaevealvqaveklgtgrwrdvklcafedadhrtyvdlkdkwk
tlvhtakispqqrrgepvpqellnrvlnahgywtqqqmqqlqqnv
Download sequence
Identical sequences 2ajeA 2aje_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]