SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2alyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2alyA
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.05e-131
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2alyA   PDB: 2aly
Sequence length 266
Comment (A:)
Sequence
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl
Download sequence
Identical sequences 2akw_A 2aly_A 2amc_A 2alyA 000007016|e1jjcA1|314.1.1.8|A:85-350 000079528|e1pysA1|314.1.1.8|A:85-350 000079529|e1eiyA2|314.1.1.8|A:85-350 000079530|e2amcA1|314.1.1.8|A:1-266 000079531|e2alyA1|314.1.1.8|A:1-266 000079532|e2iy5A2|314.1.1.8|A:85-350 000079534|e2akwA1|314.1.1.8|A:1-266 000135707|e3hfzA1|314.1.1.8|A:85-350 000214052|e3tehA1|314.1.1.8|A:85-350 001513071|e4tvaA1|314.1.1.8|A:85-350 cath|current|1jjcA00/85-350 cath|current|1pysA00/85-350 cath|current|2akwA00/85-350 cath|current|2alyA00/85-350 cath|current|2amcA00/85-350 cath|current|3hfzA00/85-350 cath|current|3tehA00/85-350 d1eiya2 d1jjca_ d1pysa_ d2akwa_ d2alya_ d2amca_ d2iy5a2 d3hfza_ d3teha_ d4tvaa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]