SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ao9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ao9A
Domain Number 1 Region: 13-132
Classification Level Classification E-value
Superfamily Homeodomain-like 8.21e-65
Family Nanomeric phage protein-like 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ao9A   PDB: 2ao9
Sequence length 155
Comment (A:)
Sequence
MPFSISGRKGSEMMAKLDELKQKLTAKQIQAAYLLVENELMESNNEEKRTQDEMANELGI
NRTTLWEWRTKNQDFIAFKSEVADSFLAEKREQVYSKLMQLILGPQPSVKAMQLYMQRFG
LLTDKKVIEGDLGNATRTNAEIEEQLQKLKKLTGE
Download sequence
Identical sequences A0A2A8WBB5 C2SZS3 C3DU66 Q81ES4
APC22852 226900.BC1890 2ao9_A 2ao9_B 2ao9_C 2ao9_D 2ao9_E 2ao9_F 2ao9_G 2ao9_H 2ao9_I gi|30020032|ref|NP_831663.1| gi|31415784|ref|NP_852524.1| 2ao9A NP_831663.1.86172 WP_002195385.1.25290 WP_002195385.1.26637 WP_002195385.1.27446 WP_002195385.1.58822 WP_002195385.1.75891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]