SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2aphA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2aphA
Domain Number 1 Region: 3-163
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.54e-70
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2aphA   PDB: 2aph
Sequence length 165
Comment (A:)
Sequence
vcpniikrsawearethcpkmnlpakyviiihtagtsctvstdcqtvvrniqsfhmdtrn
fcdigyhflvgqdggvyegvgwhiqgshtygfndialgiafigyfvekppnaaaleaaqd
liqcavvegyltpnyllmghsdvvnilspgqalyniistwphfkh
Download sequence
Identical sequences 001900460|e2aphA1|285.1.1.1|A:1-165 001900461|e2aphB1|285.1.1.1|B:1-165 001903423|e1sk3A1|285.1.1.1|A:1-165 001903538|e1twqA1|285.1.1.1|A:1-165 cath|current|1sk3A00/177-341 cath|current|1twqA00/177-341 cath|current|2aphA00/177-341 cath|current|2aphB00/177-341 d1sk3a_ d1twqa_ d2apha_ d2aphb_ 2aphA 1sk3_A 1twq_A 2aph_A 2aph_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]