SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2aqeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2aqeA
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily Homeodomain-like 1.87e-24
Family SWIRM domain 0.00000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2aqeA   PDB: 2aqe
Sequence length 90
Comment (A:)
Sequence
gsnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrl
aqaralikidvnktrkiydfliregyitka
Download sequence
Identical sequences 001159842|e2aqfA2|101.1.1.60|A:1-90 2aqeA 2aqe_A 2aqf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]