SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2b4yA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2b4yA
Domain Number 1 Region: 11-268
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.32e-118
Family Sir2 family of transcriptional regulators 0.0000000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2b4yA   PDB: 2b4y
Sequence length 271
Comment (A:)
Sequence
gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
aefntettpatnrfrfhfqgpcgttlpeala
Download sequence
Identical sequences 2b4y_A 2b4y_B 2b4y_C 2b4y_D 2nyr_A 2nyr_B 2b4yA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]