SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2b6cA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2b6cA
Domain Number 1 Region: 7-217
Classification Level Classification E-value
Superfamily ARM repeat 2.01e-45
Family BC3264-like 0.0000000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2b6cA   PDB: 2b6c
Sequence length 220
Comment (A:)
Sequence
snamdtlqfqknpetaakmsaymkhqfvfagipaperqalskqllkeshtwpkeklcqei
eayyqktereyqyvaidlalqnvqrfsleevvafkayvpqkawwdsvdawrkffgswval
hltelptifalfygaenfwnrrvalnlqlmlkektnqdllkkaiiydrtteeffiqkaig
wslrqysktnpqwveelmkelvlsplaqregskylakase
Download sequence
Identical sequences 2b6c_A 2b6c_B 2b6cA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]