SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bcqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bcqA
Domain Number 1 Region: 150-334
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.27e-82
Family DNA polymerase beta-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.32e-35
Family DNA polymerase beta, N-terminal domain-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 90-144
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.31e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bcqA   PDB: 2bcq
Sequence length 335
Comment (A:)
Sequence
maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
hgckvgpgrvlptptekdvfrllglpyrepaerdw
Download sequence
Identical sequences 2bcqA 1xsl_A 1xsl_E 1xsl_I 1xsl_M 2bcq_A 2bcr_A 2bcs_A 2bcu_A 2bcv_A 2gws_A 2gws_E 2gws_I 2gws_M 4xrh_A 4xrh_B 5ddm_A 5ddm_B 5ddy_A 5ddy_C 5ddy_E 5ddy_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]