SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bfeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bfeA
Domain Number 1 Region: 28-394
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.02e-113
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bfeA   PDB: 2bfe
Sequence length 399
Comment (A:)
Sequence
sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgaareagvlm
yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighstsddssafr
svdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpn
llfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
Download sequence
Identical sequences 2bfeA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]