SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bgxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bgxA
Domain Number 1 Region: 28-172
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 2.05e-56
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000367
Further Details:      
 
Domain Number 2 Region: 183-258
Classification Level Classification E-value
Superfamily PGBD-like 2.41e-21
Family Peptidoglycan binding domain, PGBD 0.00000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bgxA   PDB: 2bgx
Sequence length 261
Comment (A:)
Sequence
mgagekgivekegyqldtrrqaqaayprikvlvihytaddfdsslatltdkqvsshylvp
avppryngkpriwqlvpeqelawhagisawrgatrlndtsigielenrgwqksagvkyfa
pfepaqiqaliplakdiiaryhikpenvvahadiapqrkddpgplfpwqqlaqqgigawp
daqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptlyn
geadaetqaiaeallekygqd
Download sequence
Identical sequences 2bh7_A 2wkx_A 3d2y_A 3d2z_A 2bgxA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]