SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bn2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bn2A
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily Neurophysin II 1.83e-37
Family Neurophysin II 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bn2A   PDB: 2bn2   SUPERFAMILY: 2bn2A
Sequence length 95
Comment (A:)
Sequence
amsdlelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccndescvtepecregvgfprrv
Download sequence
Identical sequences 2bn2A 1npo_A 2bn2_A 2bn2_C 2bn2_E 2bn2_G cath|current|1npoA00/5-85 cath|current|2bn2A00/1-85 cath|current|2bn2C00/7-85 cath|current|2bn2E00/7-85 cath|current|2bn2G00/7-85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]