SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bp7B from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bp7B
Domain Number 1 Region: 4-222
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.35e-69
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000123
Further Details:      
 
Domain Number 2 Region: 207-337
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.03e-43
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bp7B   PDB: 2bp7
Sequence length 339
Comment (B:)
Sequence
MATTTMTMIQALRSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQTKYGKSRVFDAPI
SESGIVGTAVGMGAYGLRPVVEIQFADYFYPASDQIVSEMARLRYRSAGEFIAPLTLRMP
CGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEPKRLYN
GPFDGHHDRPVTPWSKHPHSAVPDGYYTVPLDKAAITRPGNDVSVLTYGTTVYVAQVAAE
ESGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVVVHEATRTCGFGAELVSLVQEHCFHHL
EAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKKVMEV
Download sequence
Identical sequences P09061
2bp7B 2bp7_B 2bp7_D 2bp7_F 2bp7_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]