SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bt6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bt6A
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.45e-46
Family 2Fe-2S ferredoxin-related 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bt6A   PDB: 2bt6
Sequence length 108
Comment (A:)
Sequence
gssgdkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlife
qhifekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
Download sequence
Identical sequences 2bt6A 2bt6_A 2bt6_B cath|current|2bt6A00/4-108 cath|current|2bt6B00/5-108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]