SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bxkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bxkA
Domain Number 1 Region: 200-378
Classification Level Classification E-value
Superfamily Serum albumin-like 5.33e-77
Family Serum albumin-like 0.00056
Further Details:      
 
Domain Number 2 Region: 389-576
Classification Level Classification E-value
Superfamily Serum albumin-like 3.12e-73
Family Serum albumin-like 0.00072
Further Details:      
 
Domain Number 3 Region: 6-186
Classification Level Classification E-value
Superfamily Serum albumin-like 1.08e-69
Family Serum albumin-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2bxkA   PDB: 2bxk
Sequence length 585
Comment (A:)
Sequence
dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
kldelrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltk
vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
lvnrrpcfsalevdetyvpkefnaetftfhadictlsekeeqikkqtalvelvkhkpkat
keqlkavmddfaafvekcckaddketcfaeegkklvaasqaalgl
Download sequence
Identical sequences 2bxi_A 2bxk_A 2bxq_A 2xsi_A 2xvv_A 2xvw_A 2bxkA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]