SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2c5sA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2c5sA
Domain Number 1 Region: 185-389
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.8e-54
Family ThiI-like 0.00000000997
Further Details:      
 
Domain Number 2 Region: 13-183
Classification Level Classification E-value
Superfamily THUMP domain-like 3.9e-52
Family THUMP domain 0.0000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2c5sA   PDB: 2c5s
Sequence length 413
Comment (A:)
Sequence
mgsshhhhhhmtyeyilvrygemttkgknrskfvstlkdnvkfklkkfpnikidathdrm
yiqlngedheavserlkdvfgihkfnlamkvpseledikkgalaaflqvkgdvktfkitv
hrsykhfpmrtmellpeigghilenteditvdvhnpdvnvrveirsgysyimcdermgag
glpvgvggkvmvllsggidspvaayltmkrgvsveavhfhsppftserakqkvidlaqel
tkyckrvtlhlvpftevqktinkeipssysmtvmrrmmmriteriaeernalaittgesl
gqvasqtldsmhtinevtnypvirplitmdkleiikiaeeigtydisirpyedcctvftp
aspatkpkrekanrfeakydftplideavanketmvlqtvevvaeeekfeelf
Download sequence
Identical sequences 2c5sA 2c5s_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]