SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2c75A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2c75A
Domain Number 1 Region: 1-310,414-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.73e-77
Family FAD-linked reductases, N-terminal domain 0.0000000000432
Further Details:      
 
Domain Number 2 Region: 290-400
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.01e-35
Family L-aminoacid/polyamine oxidase 0.000000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2c75A   PDB: 2c75
Sequence length 520
Comment (A:)
Sequence
msnkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsy
vgptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwr
tmddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethev
salwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidq
trenvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvplgsvikcivy
ykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeer
lkklcelyakvlgslealepvhyeeknwceeqysggcyttyfppgiltqygrvlrqpvdr
iyfagtetathwsglmegaveageraareilhamgkipedeiwqsepesvdvpaqpittt
flerhlpsvpgllrliglttifsatalgflahkrgllvrv
Download sequence
Identical sequences 2c75_A 2c75_B 2c75A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]