SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2c9wC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2c9wC
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily POZ domain 4.39e-38
Family BTB/POZ domain 0.00000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2c9wC   PDB: 2c9w
Sequence length 97
Comment (C:)
Sequence
mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
yftykvrytnssteipefpiapeialellmaanfldc
Download sequence
Identical sequences 001177346|e4b95K2|226.1.1.6|K:1-97 001177349|e4b9kB2|226.1.1.6|B:1-97 001177357|e4b9kK2|226.1.1.6|K:1-97 001177361|e4awjK2|226.1.1.6|K:1-97 001280812|e4bksK1|226.1.1.6|K:1-97 001280816|e4bktK1|226.1.1.6|K:1-97 001349220|e4w9cK1|226.1.1.6|K:1-97 001349236|e4w9dK1|226.1.1.6|K:1-97 001349252|e4w9eK1|226.1.1.6|K:1-97 001349265|e4w9fB1|226.1.1.6|B:1-97 001349268|e4w9fK1|226.1.1.6|K:1-97 001349284|e4w9gK1|226.1.1.6|K:1-97 001349308|e4w9hK1|226.1.1.6|K:1-97 001349316|e4w9iK1|226.1.1.6|K:1-97 001349332|e4w9jK1|226.1.1.6|K:1-97 001349348|e4w9kK1|226.1.1.6|K:1-97 001349364|e4w9lK1|226.1.1.6|K:1-97 001565034|e5bo4C1|226.1.1.6|C:1-97 001565036|e5bo4I1|226.1.1.6|I:1-97 001565037|e5bo4L1|226.1.1.6|L:1-97 001918323|e5lliB1|226.1.1.6|B:1-97 001918324|e5lliE1|226.1.1.6|E:1-97 001918325|e5lliH1|226.1.1.6|H:1-97 001918326|e5lliK1|226.1.1.6|K:1-97 002037009|e5t35C1|226.1.1.6|C:1-97 002037010|e5t35G1|226.1.1.6|G:1-97 cath|current|2c9wC00/17-112 cath|current|2izvC00/17-112 cath|current|3dcgB00/17-112 cath|current|3dcgD00/17-112 cath|current|3zngB00/18-112 cath|current|3zngE00/18-112 cath|current|3zrcB00/17-112 cath|current|3zrcE00/17-112 cath|current|3zrcH00/17-112 cath|current|3zrcK00/17-112 cath|current|3zrfB00/17-112 cath|current|3zrfE00/17-112 cath|current|3zrfH00/17-112 cath|current|3zrfK00/17-112 cath|current|3ztcB00/17-112 cath|current|3ztcE00/17-112 cath|current|3ztcH00/17-112 cath|current|3ztcK00/17-112 cath|current|3ztdB00/17-112 cath|current|3ztdE00/17-112 cath|current|3ztdH00/17-112 cath|current|3ztdK00/17-112 cath|current|3zunB00/17-112 cath|current|3zunE00/17-112 cath|current|3zunH00/17-112 cath|current|3zunK00/17-112 cath|current|4ajyC00/17-112 cath|current|4awjB00/17-112 cath|current|4awjE00/17-112 cath|current|4awjH00/17-112 cath|current|4awjK00/16-112 cath|current|4b95B00/17-112 cath|current|4b95E00/17-112 cath|current|4b95H00/17-112 cath|current|4b95K00/16-112 cath|current|4b9kB00/16-112 cath|current|4b9kH00/17-112 cath|current|4b9kK00/16-112 cath|current|4bksB00/17-112 cath|current|4bksE00/17-112 cath|current|4bksH00/17-112 cath|current|4bksK00/16-112 cath|current|4bktB00/17-112 cath|current|4bktE00/17-112 cath|current|4bktH00/17-112 cath|current|4bktK00/16-112 cath|current|4w9cB00/17-112 cath|current|4w9cE00/17-112 cath|current|4w9cH00/17-112 cath|current|4w9cK00/16-112 cath|current|4w9dB00/17-112 cath|current|4w9dE00/17-112 cath|current|4w9dH00/17-112 cath|current|4w9dK00/16-112 cath|current|4w9eB00/17-112 cath|current|4w9eE00/17-112 cath|current|4w9eH00/17-112 cath|current|4w9eK00/16-112 cath|current|4w9gB00/17-112 cath|current|4w9gE00/17-112 cath|current|4w9gH00/17-112 cath|current|4w9gK00/16-112 cath|current|4w9hH00/17-112 cath|current|4w9hK00/16-112 cath|current|4w9iB00/17-112 cath|current|4w9iE00/17-112 cath|current|4w9iH00/17-112 cath|current|4w9iK00/16-112 cath|current|4w9jB00/17-112 cath|current|4w9jE00/17-112 cath|current|4w9jH00/17-112 cath|current|4w9jK00/16-112 cath|current|4w9kB00/17-112 cath|current|4w9kE00/17-112 cath|current|4w9kH00/17-112 cath|current|4w9kK00/16-112 cath|current|4w9lB00/17-112 cath|current|4w9lE00/17-112 cath|current|4w9lH00/17-112 cath|current|4w9lK00/16-112 2c9w_C 2izv_C 3dcg_B 3dcg_D 3zng_B 3zng_E 3zrc_B 3zrc_E 3zrc_H 3zrc_K 3zrf_B 3zrf_E 3zrf_H 3zrf_K 3ztc_B 3ztc_E 3ztc_H 3ztc_K 3ztd_B 3ztd_E 3ztd_H 3ztd_K 3zun_B 3zun_E 3zun_H 3zun_K 4ajy_C 4awj_B 4awj_E 4awj_H 4awj_K 4b95_B 4b95_E 4b95_H 4b95_K 4b9k_B 4b9k_E 4b9k_H 4b9k_K 4bks_B 4bks_E 4bks_H 4bks_K 4bkt_B 4bkt_E 4bkt_H 4bkt_K 4w9c_B 4w9c_E 4w9c_H 4w9c_K 4w9d_B 4w9d_E 4w9d_H 4w9d_K 4w9e_B 4w9e_E 4w9e_H 4w9e_K 4w9f_B 4w9f_E 4w9f_H 4w9f_K 4w9g_B 4w9g_E 4w9g_H 4w9g_K 4w9h_B 4w9h_E 4w9h_H 4w9h_K 4w9i_B 4w9i_E 4w9i_H 4w9i_K 4w9j_B 4w9j_E 4w9j_H 4w9j_K 4w9k_B 4w9k_E 4w9k_H 4w9k_K 4w9l_B 4w9l_E 4w9l_H 4w9l_K 5bo4_C 5bo4_F 5bo4_I 5bo4_L 5bo4_O 5bo4_R 5lli_B 5lli_E 5lli_H 5lli_K 5n4w_C 5nvv_B 5nvv_E 5nvv_H 5nvv_K 5nvw_B 5nvw_E 5nvw_H 5nvw_K 5nvx_B 5nvx_E 5nvx_H 5nvx_K 5nvy_B 5nvy_E 5nvy_H 5nvy_K 5nvz_B 5nvz_E 5nvz_H 5nvz_K 5nw0_B 5nw0_E 5nw0_H 5nw0_K 5nw1_B 5nw1_E 5nw1_H 5nw1_K 5nw2_B 5nw2_E 5nw2_H 5nw2_K 5t35_C 5t35_G 6fmi_B 6fmi_E 6fmj_B 6fmj_E 6fmj_H 6fmj_K 6fmk_B 6fmk_E 6fmk_H 6fmk_K 6gfx_B 6gfy_B 6gfy_E 6gfy_H 6gfy_K 6gfz_B 6gfz_E 6gfz_H 6gfz_K 6gmn_B 6gmn_E 6gmn_H 6gmn_K 6gmq_B 6gmq_E 6gmq_H 6gmq_K 6gmr_C 6gmx_B 6gmx_E 6gmx_H 6gmx_K 2c9wC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]