SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ca6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ca6A
Domain Number 1 Region: 16-320
Classification Level Classification E-value
Superfamily RNI-like 1.34e-58
Family Rna1p (RanGAP1), N-terminal domain 0.0000000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ca6A   PDB: 2ca6
Sequence length 386
Comment (A:)
Sequence
marfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskk
dleiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflsk
htplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewa
ktfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaial
kswpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvide
kmpdllflelngnrfseeddvvdeirevfstrgrgeldelddmeeltdeeeedeeeeaes
qspepetseeekedkeladelskahi
Download sequence
Identical sequences 2ca6A 1k5d_C 1k5d_F 1k5d_I 1k5d_L 1k5g_C 1k5g_F 1k5g_I 1k5g_L 2ca6_A 2ca6_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]