SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cb3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cb3A
Domain Number 1 Region: 7-167
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 2.12e-66
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cb3A   PDB: 2cb3
Sequence length 175
Comment (A:)
Sequence
ghelsaiiprsswlaqkpmdeplplqlpvkyvvilhtatessekrainvrlirdmqsfhi
esrgwndiaynflvgcdgniyegrgwktvgahtlgynrislgisfigcfmkelptadaln
mcrnllargvedghistdyrlichcqcnstespgrrlyeeiqtwphfynieeeeq
Download sequence
Identical sequences cath|current|2cb3A00/174-344 cath|current|2cb3B00/175-344 cath|current|2cb3C00/171-344 cath|current|2cb3D00/174-344 2cb3_A 2cb3_B 2cb3_C 2cb3_D 2cb3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]