SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cjjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cjjA
Domain Number 1 Region: 11-64
Classification Level Classification E-value
Superfamily Homeodomain-like 2.74e-19
Family Myb/SANT domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cjjA   PDB: 2cjj
Sequence length 93
Comment (A:)
Sequence
MASTRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDI
KYIESGKVPFPNYRTTGGNMKTDEKRFRNLKIR
Download sequence
Identical sequences Q58FS3
2cjj_A 2cjjA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]