SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ckxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ckxA
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Homeodomain-like 1.81e-17
Family Myb/SANT domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ckxA   PDB: 2ckx
Sequence length 83
Comment (A:)
Sequence
rpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiapqqr
rgepvpqdlldrvlaahaywsqq
Download sequence
Identical sequences 2ckxA 000002493|e2ckxA1|101.1.1.351|A:1-83 d2ckxa1 2ckx_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]