SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2comA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2comA
Domain Number 1 Region: 22-105
Classification Level Classification E-value
Superfamily Homeodomain-like 1.19e-36
Family SWIRM domain 0.00000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2comA   PDB: 2com
Sequence length 124
Comment (A:)
Sequence
gssgssgeepsgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlw
ldnpkiqltfeatlqqleapynsdtvlvhrvhsylerhglinfgiykrikplptkktgsg
pssg
Download sequence
Identical sequences 2comA cath|current|2comA00/1-124 2com_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]