SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cqqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cqqA
Domain Number 1 Region: 10-60
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000302
Family Myb/SANT domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cqqA   PDB: 2cqq
Sequence length 72
Comment (A:)
Sequence
gssgssgapewteedlsqltrsmvkfpggtpgrwekiahelgrsvtdvttkakqlkdsvt
cspgmvsgpssg
Download sequence
Identical sequences 2cqqA 2cqq_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]