SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cqrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cqrA
Domain Number 1 Region: 21-68
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000564
Family Myb/SANT domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cqrA   PDB: 2cqr
Sequence length 73
Comment (A:)
Sequence
gssgssgslrkerarsaeepwtqnqqkllelalqqyprgssdcwdkiarcvpskskedci
arykllvsgpssg
Download sequence
Identical sequences 2cqrA 2cqr_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]