SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cqxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cqxA
Domain Number 1 Region: 14-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000606
Family Homeodomain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cqxA   PDB: 2cqx
Sequence length 72
Comment (A:)
Sequence
gssgssggikdspvnkvepndtlekvfvsvtkypdekrlkglskqldwsvrkiqcwfrhr
rnqdkpsgpssg
Download sequence
Identical sequences 001031634|e2cqxA1|101.1.1.10|A:1-72 2cqxA 2cqx_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]