SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2craA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2craA
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Homeodomain-like 2.85e-22
Family Homeodomain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2craA   PDB: 2cra
Sequence length 70
Comment (A:)
Sequence
gssgssgrkkripyskgqlrelereyaankfitkdkrrkisaatslserqitiwfqnrrv
kekksgpssg
Download sequence
Identical sequences 2craA 2cra_A 001160052|e2craA2|101.1.1.76|A:1-70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]