SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2crgA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2crgA
Domain Number 1 Region: 9-61
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000533
Family Myb/SANT domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2crgA   PDB: 2crg
Sequence length 70
Comment (A:)
Sequence
gssgssgmeewsaseaclfeealekygkdfndirqdflpwksltsiieyyymwkttdryv
qqkrsgpssg
Download sequence
Identical sequences 2crgA 2crg_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]