SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ctfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ctfA
Domain Number 1 Region: 34-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.62e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ctfA   PDB: 2ctf
Sequence length 102
Comment (A:)
Sequence
gssgssgepeklgqaltevyakansftvssvaapswlhrfiigkkgqnlakitqqmpkvh
ieftegedkitlegptedvsvaqeqiegmvkdlinrsgpssg
Download sequence
Identical sequences 2ctf_A cath|current|2ctfA00/1-102 2ctfA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]