SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ctlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ctlA
Domain Number 1 Region: 21-90
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.74e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ctlA   PDB: 2ctl
Sequence length 97
Comment (A:)
Sequence
gssgssgeqedralrsfklsvtvdpkyhpkiigrkgavitqirlehdvniqfpdkddgnq
pqdqititgyeknteaardailrivgeleqmsgpssg
Download sequence
Identical sequences 2ctl_A 2ctlA cath|current|2ctlA00/1-97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]