SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cu7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cu7A
Domain Number 1 Region: 12-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000395
Family Myb/SANT domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cu7A   PDB: 2cu7
Sequence length 72
Comment (A:)
Sequence
gssgssgysvkwtieekelfeqglakfgrrwtkiskligsrtvlqvksyarqyfknkvkc
gldketpnqktg
Download sequence
Identical sequences 2cu7_A 2cu7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]