SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cufA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cufA
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-23
Family Homeodomain 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cufA   PDB: 2cuf
Sequence length 95
Comment (A:)
Sequence
gssgssgrgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdler
vtslkvynwfanrrkeikrraniaailessgpssg
Download sequence
Identical sequences 2cuf_A 2cufA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]