SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2cujA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2cujA
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily Homeodomain-like 5.93e-25
Family SWIRM domain 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2cujA   PDB: 2cuj
Sequence length 108
Comment (A:)
Sequence
gssgssgidsglspsvlmasnsgrrsapplnltglpgteklnekekelcqvvrlvpgayl
eyksallnechkqgglrlaqaralikidvnktrkiydfliregyitka
Download sequence
Identical sequences 2cuj_A 2cujA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]