SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2d13A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2d13A
Domain Number 1 Region: 5-224
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.74e-74
Family N-type ATP pyrophosphatases 0.00000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2d13A   PDB: 2d13
Sequence length 227
Comment (A:)
Sequence
MVGLADVAVLYSGGKDSNYALYWALKSGLRVRYLVSMVSENEESYMYHTPNVELTSLQAR
ALGIPIIKGFTKGEKEKEVEDLKNVLEGLKVDGIVAGALASRYQKERIENVARELGLKVY
TPAWEKDPYQYMLEIIKLGFKVVFVAVSAYGLNESWLGRELNYKNLEELKKLSEKYGIHI
AGEGGEFETFVLDMPFFKAKIVIDDAEKFWDGLSGKFIIKRAHLEWK
Download sequence
Identical sequences O58996
2d13_A 2d13_B 2d13_C 2d13_D gi|14591076|ref|NP_143151.1| WP_010885347.1.38245 pho001001257.1 2d13A 70601.PH1257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]